Review



rabbit polyclonal antibody against human transferrin  (Agilent technologies)


Bioz Verified Symbol Agilent technologies is a verified supplier
Bioz Manufacturer Symbol Agilent technologies manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 90
      Buy from Supplier

    Structured Review

    Agilent technologies rabbit polyclonal antibody against human transferrin
    Fig. 2. Sequences of the tryptic glycopeptide and the major glycoforms of <t>transferrin.</t>
    Rabbit Polyclonal Antibody Against Human Transferrin, supplied by Agilent technologies, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/rabbit+polyclonal+antibody+against+human+transferrin/pmc07242785-30-8-14
    Average 90 stars, based on 1 article reviews
    rabbit polyclonal antibody against human transferrin - by Bioz Stars, 2026-09
    90/100 stars

    Images

    1) Product Images from "Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry to Detect Diagnostic Glycopeptide Markers of Congenital Disorders of Glycosylation"

    Article Title: Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry to Detect Diagnostic Glycopeptide Markers of Congenital Disorders of Glycosylation

    Journal: Mass Spectrometry

    doi: 10.5702/massspectrometry.A0084

    Fig. 2. Sequences of the tryptic glycopeptide and the major glycoforms of transferrin.
    Figure Legend Snippet: Fig. 2. Sequences of the tryptic glycopeptide and the major glycoforms of transferrin.

    Techniques Used:

    Fig. 3. MALDI linear TOF mass spectrum of tryptic peptides of transferrin obtained from a healthy individual. The peaks indicated by sequence numbers in parentheses are ions without glycosylation sites. Their sequences are AIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSK (51–88) and AVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFK (149–193). Glycoforms at site-1 and site-2 are displayed in the lower and higher mass regions, respectively.
    Figure Legend Snippet: Fig. 3. MALDI linear TOF mass spectrum of tryptic peptides of transferrin obtained from a healthy individual. The peaks indicated by sequence numbers in parentheses are ions without glycosylation sites. Their sequences are AIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSK (51–88) and AVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFK (149–193). Glycoforms at site-1 and site-2 are displayed in the lower and higher mass regions, respectively.

    Techniques Used: Sequencing

    Fig. 4. MALDI reflectron TOF mass spectra of tryptic peptides of transferrin. (a) CDG-I patient. Arrows indicate diagnostic ions. This patient is a compound heterozygote for ALG1 mutations and has a mutation in the SSR4 gene which is also among the candidate causes of CDG-I type abnormalities. (b) Healthy individual. Broken arrows indicate the positions of diagnostic ions; it is noteworthy that a small peak at m / z 2525.1 is observed in this unaffected subject.
    Figure Legend Snippet: Fig. 4. MALDI reflectron TOF mass spectra of tryptic peptides of transferrin. (a) CDG-I patient. Arrows indicate diagnostic ions. This patient is a compound heterozygote for ALG1 mutations and has a mutation in the SSR4 gene which is also among the candidate causes of CDG-I type abnormalities. (b) Healthy individual. Broken arrows indicate the positions of diagnostic ions; it is noteworthy that a small peak at m / z 2525.1 is observed in this unaffected subject.

    Techniques Used: Diagnostic Assay, Mutagenesis

    Fig. 5. MALDI linear TOF mass spectrum of tryptic peptides of transferrin from patients with various types of CDG-II.
    Figure Legend Snippet: Fig. 5. MALDI linear TOF mass spectrum of tryptic peptides of transferrin from patients with various types of CDG-II.

    Techniques Used:

    Related Articles

    Affinity Column:

    Article Title: L-Fucose treatment of FUT8-CDG
    Article Snippet: .. Briefly, an affinity column for transferrin was prepared using a rabbit polyclonal antibody against human transferrin (Dako, Glostrup, Denmark) and a ligand-coupling Sepharose column (HiTrap NHS-activated HP, GE Healthcare, NJ, USA). .. For IgG, a protein G-coupled Sepharose column was purchased from GE Healthcare.

    Article Title: Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry to Detect Diagnostic Glycopeptide Markers of Congenital Disorders of Glycosylation
    Article Snippet: .. Briefly, an affinity column was prepared using a rabbit polyclonal antibody against human transferrin (DAKO, Denmark) and a ligand-coupling Sepharose column (HiTrap NHS-activated HP, GE Healthcare, Piscataway, NJ, USA), and the antibody-coupled Sepharose was recovered from the column. ..

    Article Title: Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry to Detect Diagnostic Glycopeptide Markers of Congenital Disorders of Glycosylation
    Article Snippet: .. 12) Briefly, an affinity column was prepared using rabbit polyclonal antibody against human transferrin (DAKO, Denmark) and a ligandcoupling Sepharose column (HiTrap NHS-activated HP, GE Healthcare, Piscataway, NJ), and the antibody-coupled Sepharose was recovered from the column. ..

    Purification:

    Article Title: Clinical and molecular findings in three Japanese patients with N -acetylneuraminic acid synthetase-congenital disorder of glycosylation (NANS-CDG)
    Article Snippet: .. In brief, each protein was purified from serum by immunoaffinity with rabbit polyclonal antibody against human transferrin (Dako) or goat polyclonal antibody against human apolipoprotein C-III (Academy Bio-Medical Co), and was subjected to liquid chromatography-ESI–MS using a reversed-phase, C4 for transferrin and C8 for apolipoprotein C-III, minicolumn and an API4500 quadrupole mass spectrometer (Sciex). .. The obtained mass spectrum of multiply-charged ions was transformed into a single-charge spectrum using a Promass protein deconvolution software (ThermoFisher Scientific).

    Chromatography:

    Article Title: Clinical and molecular findings in three Japanese patients with N -acetylneuraminic acid synthetase-congenital disorder of glycosylation (NANS-CDG)
    Article Snippet: .. In brief, each protein was purified from serum by immunoaffinity with rabbit polyclonal antibody against human transferrin (Dako) or goat polyclonal antibody against human apolipoprotein C-III (Academy Bio-Medical Co), and was subjected to liquid chromatography-ESI–MS using a reversed-phase, C4 for transferrin and C8 for apolipoprotein C-III, minicolumn and an API4500 quadrupole mass spectrometer (Sciex). .. The obtained mass spectrum of multiply-charged ions was transformed into a single-charge spectrum using a Promass protein deconvolution software (ThermoFisher Scientific).

    Mass Spectrometry:

    Article Title: Clinical and molecular findings in three Japanese patients with N -acetylneuraminic acid synthetase-congenital disorder of glycosylation (NANS-CDG)
    Article Snippet: .. In brief, each protein was purified from serum by immunoaffinity with rabbit polyclonal antibody against human transferrin (Dako) or goat polyclonal antibody against human apolipoprotein C-III (Academy Bio-Medical Co), and was subjected to liquid chromatography-ESI–MS using a reversed-phase, C4 for transferrin and C8 for apolipoprotein C-III, minicolumn and an API4500 quadrupole mass spectrometer (Sciex). .. The obtained mass spectrum of multiply-charged ions was transformed into a single-charge spectrum using a Promass protein deconvolution software (ThermoFisher Scientific).



    Similar Products

    rabbit polyclonal antibody against human transferrin  (Agilent technologies)
    90
    Agilent technologies rabbit polyclonal antibody against human transferrin
    Fig. 2. Sequences of the tryptic glycopeptide and the major glycoforms of <t>transferrin.</t>
    Rabbit Polyclonal Antibody Against Human Transferrin, supplied by Agilent technologies, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/rabbit+polyclonal+antibody+against+human+transferrin/pmc07242785-30-8-14
    Average 90 stars, based on 1 article reviews
    rabbit polyclonal antibody against human transferrin - by Bioz Stars, 2026-09
    90/100 stars
    		  Buy from Supplier
    polyclonal rabbit antibodies against human transferrin  (Agilent technologies)
    90
    Agilent technologies polyclonal rabbit antibodies against human transferrin
    Fig. 2. Sequences of the tryptic glycopeptide and the major glycoforms of <t>transferrin.</t>
    Polyclonal Rabbit Antibodies Against Human Transferrin, supplied by Agilent technologies, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/rabbit+polyclonal+antibody+against+human+transferrin/pm17320850-70-7-13
    Average 90 stars, based on 1 article reviews
    polyclonal rabbit antibodies against human transferrin - by Bioz Stars, 2026-09
    90/100 stars
    		  Buy from Supplier

    Image Search Results


    Fig. 2. Sequences of the tryptic glycopeptide and the major glycoforms of transferrin.

    Journal: Mass Spectrometry

    Article Title: Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry to Detect Diagnostic Glycopeptide Markers of Congenital Disorders of Glycosylation

    doi: 10.5702/massspectrometry.A0084

    Figure Lengend Snippet: Fig. 2. Sequences of the tryptic glycopeptide and the major glycoforms of transferrin.

    Article Snippet: Briefly, an affinity column was prepared using a rabbit polyclonal antibody against human transferrin (DAKO, Denmark) and a ligand-coupling Sepharose column (HiTrap NHS-activated HP, GE Healthcare, Piscataway, NJ, USA), and the antibody-coupled Sepharose was recovered from the column.

    Techniques:

    Fig. 3. MALDI linear TOF mass spectrum of tryptic peptides of transferrin obtained from a healthy individual. The peaks indicated by sequence numbers in parentheses are ions without glycosylation sites. Their sequences are AIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSK (51–88) and AVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFK (149–193). Glycoforms at site-1 and site-2 are displayed in the lower and higher mass regions, respectively.

    Journal: Mass Spectrometry

    Article Title: Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry to Detect Diagnostic Glycopeptide Markers of Congenital Disorders of Glycosylation

    doi: 10.5702/massspectrometry.A0084

    Figure Lengend Snippet: Fig. 3. MALDI linear TOF mass spectrum of tryptic peptides of transferrin obtained from a healthy individual. The peaks indicated by sequence numbers in parentheses are ions without glycosylation sites. Their sequences are AIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSK (51–88) and AVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFK (149–193). Glycoforms at site-1 and site-2 are displayed in the lower and higher mass regions, respectively.

    Article Snippet: Briefly, an affinity column was prepared using a rabbit polyclonal antibody against human transferrin (DAKO, Denmark) and a ligand-coupling Sepharose column (HiTrap NHS-activated HP, GE Healthcare, Piscataway, NJ, USA), and the antibody-coupled Sepharose was recovered from the column.

    Techniques: Sequencing

    Fig. 4. MALDI reflectron TOF mass spectra of tryptic peptides of transferrin. (a) CDG-I patient. Arrows indicate diagnostic ions. This patient is a compound heterozygote for ALG1 mutations and has a mutation in the SSR4 gene which is also among the candidate causes of CDG-I type abnormalities. (b) Healthy individual. Broken arrows indicate the positions of diagnostic ions; it is noteworthy that a small peak at m / z 2525.1 is observed in this unaffected subject.

    Journal: Mass Spectrometry

    Article Title: Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry to Detect Diagnostic Glycopeptide Markers of Congenital Disorders of Glycosylation

    doi: 10.5702/massspectrometry.A0084

    Figure Lengend Snippet: Fig. 4. MALDI reflectron TOF mass spectra of tryptic peptides of transferrin. (a) CDG-I patient. Arrows indicate diagnostic ions. This patient is a compound heterozygote for ALG1 mutations and has a mutation in the SSR4 gene which is also among the candidate causes of CDG-I type abnormalities. (b) Healthy individual. Broken arrows indicate the positions of diagnostic ions; it is noteworthy that a small peak at m / z 2525.1 is observed in this unaffected subject.

    Article Snippet: Briefly, an affinity column was prepared using a rabbit polyclonal antibody against human transferrin (DAKO, Denmark) and a ligand-coupling Sepharose column (HiTrap NHS-activated HP, GE Healthcare, Piscataway, NJ, USA), and the antibody-coupled Sepharose was recovered from the column.

    Techniques: Diagnostic Assay, Mutagenesis

    Fig. 5. MALDI linear TOF mass spectrum of tryptic peptides of transferrin from patients with various types of CDG-II.

    Journal: Mass Spectrometry

    Article Title: Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry to Detect Diagnostic Glycopeptide Markers of Congenital Disorders of Glycosylation

    doi: 10.5702/massspectrometry.A0084

    Figure Lengend Snippet: Fig. 5. MALDI linear TOF mass spectrum of tryptic peptides of transferrin from patients with various types of CDG-II.

    Article Snippet: Briefly, an affinity column was prepared using a rabbit polyclonal antibody against human transferrin (DAKO, Denmark) and a ligand-coupling Sepharose column (HiTrap NHS-activated HP, GE Healthcare, Piscataway, NJ, USA), and the antibody-coupled Sepharose was recovered from the column.

    Techniques: